PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00076448001
Common NameGSBRNA2T00076448001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 438aa    MW: 48643.2 Da    PI: 5.9051
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00076448001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31226280155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr+rWtpeLHe+F++ v++L G+ekAtPk++l+lm+v+gLt++hvkSHLQkYRl
  GSBRNA2T00076448001 226 KPRMRWTPELHESFLKSVNKLEGPEKATPKAVLKLMNVEGLTIYHVKSHLQKYRL 280
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.015223283IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-29224281IPR009057Homeodomain-like
SuperFamilySSF466898.06E-17225280IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23226281IPR006447Myb domain, plants
PfamPF002492.1E-8228279IPR001005SANT/Myb domain
PfamPF143795.5E-22316362IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MNGHRLVPTA QEECNKGIQK ACSSSLSPAY NFLNVQPERT KSPFIRSQSP DWPKNSTFSR  60
SSTFCTNLYS SSSSANETQK HLGNSLPFLP DPSASASGVE SARSPSVFSE DLGNPFDGDN  120
NSSLVKDFFN LSADACSNGG GYHDLDCSND TLSDQLELQF LSDELELAIT DRAETPRLDE  180
IYEKPMASPN PVTVLSPSQR CDAGAMCIDP VSSLPSPRSS AAANHKPRMR WTPELHESFL  240
KSVNKLEGPE KATPKAVLKL MNVEGLTIYH VKSHLQKYRL AKYMPEKKEE KKNVNSEEKK  300
LALSNSEADE KKKGAIQLTE ALRMQMEVQK QLHEQLEVQR VLQLRIEEHA KYLEKMLEEQ  360
RKAGRLFSSS SSSQTLLSPS DDETRPDSPN MSKTEASLPQ PSSSAKNIAS ETEDDQCESP  420
QKRRRLENNT KPQDSER*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1421425KRRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00076448001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1278610.0EF127861.1 Brassica rapa subsp. chinensis MYBogu mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013673207.10.0PREDICTED: uncharacterized protein LOC106377504
RefseqXP_013673206.10.0PREDICTED: uncharacterized protein LOC106377504
TrEMBLA0A078HXW50.0A0A078HXW5_BRANA; BnaA01g30110D protein
STRINGBra039364.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.20.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]